PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02508.1.g00030.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HSF
Protein Properties Length: 416aa    MW: 45373.4 Da    PI: 6.5114
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02508.1.g00030.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind68.51.4e-2170129261
                                   HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTT CS
                  HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61 
                                   Fl+k+y+++++++l+  isw + gns+vv+d+++fa++vLp +Fkh+nf+ FvRQLn+Y 
  Zpz_sc02508.1.g00030.1.am.mk  70 FLSKTYDLVSEPALDGAISWGAAGNSIVVWDPSTFARDVLPYHFKHNNFSTFVRQLNTYS 129
                                   9**********************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.101.2E-2264129IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004156.0E-2466171IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467853.4E-2068129IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000561.6E-107093IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004472.2E-1870129IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.6E-10108120IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.6E-10121133IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MNRNRANAPE YPTSSVSMEA LLEPKLEDEA ALPLSSPGPF VPLDQLMPGP GLDPPRPLEA  60
LLQGPQLPPF LSKTYDLVSE PALDGAISWG AAGNSIVVWD PSTFARDVLP YHFKHNNFST  120
FVRQLNTYSR GVDPVTGKLN PCHGTPRSSS LDPEHTLRRE KTALLQEVAR LKQEHRQTIE  180
HMSTLNQRLE SADDRQKQMI SFLAKLLQNP TFVRQLKLQR EQKEIDSTRV KRKYLKHVPH  240
GSIESGLDAT SSEAACLASL GENTGLLSGT MLEPAANDEQ MWGIDTSAAL QSSCSGSSQQ  300
AYSSLASDPY LMEIVNKPEK FWDLDFQPLD EGDLPLDKCP SDAVQAVNGT TCGAVSCMNV  360
TAVPIIVAAT ALPRSCALRH PKPKAQTFSR APIASPRGEI GQGHRAAPNW TRGVAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ldu_A5e-16621281178Heat shock factor protein 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9567074e-86EU956707.1 Zea mays clone 1571220 mRNA sequence.
GenBankEU9571674e-86EU957167.1 Zea mays clone 1584568 heat shock factor protein 2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004952622.11e-107PREDICTED: heat stress transcription factor A-3-like
SwissprotQ6H6Q71e-104HSFA3_ORYSJ; Heat stress transcription factor A-3
TrEMBLK3YRP91e-107K3YRP9_SETIT; Uncharacterized protein
STRINGSi016943m1e-106(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90103041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03720.12e-46heat shock transcription factor A3